SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4N3I3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4N3I3
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 0.0000051
Family Nucleoplasmin-like core domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4N3I3
Sequence length 138
Comment (tr|Q4N3I3|Q4N3I3_THEPA) Uncharacterized protein {ECO:0000313|EMBL:EAN32263.1} KW=Complete proteome; Reference proteome OX=5875 OS=Theileria parva (East coast fever infection agent). GN=TP04_0909 OC=Theileriidae; Theileria.
Sequence
MLFGAVLAPGATVTPKNELANIVHLSQVCLNEPKSDERTYVQLVDGNKVYNLCSLQKDVN
EHATLDLFFSTTGDLKLTTKGGPNEVHVIGYFEPEDDAFLSDSEEEEEDELDEDEVDEED
SDDEPASKRKASNKSGKN
Download sequence
Identical sequences Q4N3I3
XP_764546.1.6148 529.m03752 gi|71029806|ref|XP_764546.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]