SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4RKD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4RKD5
Domain Number 1 Region: 37-162
Classification Level Classification E-value
Superfamily Stathmin 1.83e-50
Family Stathmin 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4RKD5
Sequence length 195
Comment (tr|Q4RKD5|Q4RKD5_TETNG) Stathmin {ECO:0000256|RuleBase:RU004388} OX=99883 OS=nigroviridis). GN=GSTENG00033008001 OC=Tetraodon.
Sequence
ASAPSAYKEKMKEISVLSLICSCLYPESRKNILGDFEDLDIKPINKRASGQAFEVLLKPS
SPVTDAAHCVTSPPKRDLSLEDIQKKLEAAEDRRRSQEAQVLQALAEKREHERDVLLRAM
EENSNFSRMAEEKLQLKMEQIEENRMAYLAAMMERLQEKVSRPAGDTPPPPPAVEGKEKH
AQEVRRNKELREALT
Download sequence
Identical sequences Q4RKD5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]