SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4Z6K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q4Z6K7
Domain Number - Region: 47-104
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.000376
Family NAD kinase-like 0.056
Further Details:      
 
Domain Number - Region: 81-183
Classification Level Classification E-value
Superfamily Clathrin heavy-chain terminal domain 0.0144
Family Clathrin heavy-chain terminal domain 0.015
Further Details:      
 
Domain Number - Region: 276-356
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.085
Family NAD kinase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4Z6K7
Sequence length 358
Comment (tr|Q4Z6K7|Q4Z6K7_PLABA) Uncharacterized protein {ECO:0000313|EMBL:CAH93989.1} KW=Complete proteome; Reference proteome OX=5823 OS=Plasmodium berghei (strain Anka). GN=PB000335.00.0 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
YKRILLIEKYTKYDNLRKQGYTDDYILKNFFSSYLSHFTHTLIVNNIINILRIKYKTHVS
IIKAYKRNIESISINSSSIFSPDAIFSVGGDGTYLESAHIIANKYIVDQDSNNENKLIEL
VGINSDPNSSEGKLCLDYCRENSNDDMNYSYTSFIEFEKTYNNKNTKKNFIFTDVSNFIN
ELKERELKIQTTNNNCEQINMKEKENKPKIEKVNESKESKQIYNDLNVLDKIMKNNLMFY
GDSTEKDNLSKKEISSNDIPIQHFLTNWCETAPKLNIRIEEYVKKILHYFFEKNKYKKIY
RKYITVYIKKSEEDQVKTYKSINEVYIHEAVKNNICTYINIDNKIVKKLKSTALLITS
Download sequence
Identical sequences Q4Z6K7
gi|68064205|ref|XP_674097.1| XP_674097.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]