SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q55U84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q55U84
Domain Number 1 Region: 81-140
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 0.00000863
Family Hypothetical protein c14orf129, hspc210 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q55U84
Sequence length 146
Comment (tr|Q55U84|Q55U84_CRYNB) Uncharacterized protein {ECO:0000313|EMBL:EAL21528.1} KW=Complete proteome OX=283643 OS=(Filobasidiella neoformans). GN=CNBD2220 OC=Cryptococcus neoformans species complex.
Sequence
MASLTSDPILLNPLSEIIAALSSSSFGILPAPDSEPLLEQTFPRTAEELKSVQEESNRSR
KISERIVGMCRVGLLDGEGHVVIRLDRAGWTIETADGERHVTNKIGTTYESMESLLISAS
KKYVEAMNREIWKRFKDHPQTIEERK
Download sequence
Identical sequences Q55U84
XP_776175.1.65578 sgtc|cn04225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]