SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5C5P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q5C5P9
Domain Number - Region: 26-118
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.00902
Family Gametocyte protein Pfg27 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5C5P9
Sequence length 179
Comment (tr|Q5C5P9|Q5C5P9_SCHJA) SJCHGC07327 protein {ECO:0000313|EMBL:AAX25025.2} OX=6182 OS=Schistosoma japonicum (Blood fluke). GN= OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
QQILSYFNASHVCLSSYNIIPVGFNDKRQFILITYHTKTKTYFCWIFKEIRQNNIQRYLA
FLFDTPQCQYYRLPSGDIEVNEKEAIARISLTSATCINCERKFDQKSKVYTSKDNLRRSN
ILRIQTNHLKQRQSQRALRQSKQLTSKSISWRNRADIFTYHLTVCLSFTAYFVNRITYL
Download sequence
Identical sequences Q5C5P9
6182.Q5C5P9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]