SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5CZX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5CZX7
Domain Number 1 Region: 53-237
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.6e-79
Family T-box 0.000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5CZX7
Sequence length 518
Comment (tr|Q5CZX7|Q5CZX7_MOUSE) T-box 5, isoform CRA_a {ECO:0000313|EMBL:EDL19780.1} OX=10090 OS=Mus musculus (Mouse). GN=mCG_124905 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MADTDEGFGLARTPLEPDSKDRSCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHE
RELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNK
WSVTGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQ
PRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKITQLKIENNPFAKGFRGSD
DLELHRMSRMQSKEYPVVPRSTVRHKVTSNHSPFSSETRALSTSSNLGSQYQCENGVSGP
SQDLLPPPNPYPLAQEHSQIYHCTKRKDEECSSTEHPYKKPYMETSPSEEDTFYRSGYPQ
QQGLSTSYRTESAQRQACMYASSAPPSEPVPSLEDISCNTWPSMPSYSSCTVTTVQPMDR
LPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPG
GLQPPEFLYTHGVPRTLSPHQYHSVHGVGMVPEWSENS
Download sequence
Identical sequences P70326 Q5CZX7
ENSMUSP00000018407 NP_035667.1.92730 XP_006530343.1.92730 XP_006530344.1.92730 XP_006530345.1.92730 XP_006530346.1.92730 XP_011246493.1.92730 XP_017176276.1.92730 ENSMUSP00000018407 ENSMUSP00000018407 10090.ENSMUSP00000018407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]