SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5G7W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5G7W5
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 2.75e-55
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0000665
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q5G7W5
Sequence length 158
Comment (tr|Q5G7W5|Q5G7W5_MACFA) Adipose differentiation-related protein {ECO:0000313|EMBL:AAW68019.1} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN=ADRP OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
ANQKIQDAQDKLYLSWVEWKRSIGYDDTDESHCAEHIESRTLEIARNLTQQLQTTCHNLL
SNIQGVPQNIQDQAKHMGVMAGDIYSVFRSAASFKEVSDSLLTSSKGQLQKMKESLDDVT
DYLVNNTPLNWLVGPFYPQLTESQNAQDQGAEMDKSSQ
Download sequence
Identical sequences Q5G7W5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]