SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q65472 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q65472
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily P40 nucleoprotein 5.62e-71
Family P40 nucleoprotein 0.0000000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q65472
Sequence length 146
Comment (tr|Q65472|Q65472_BDV1) p40 {ECO:0000313|EMBL:CAA59165.1} OX=1714621 OS=Borna disease virus 1 (BoDV-1). GN= OC=Mononegavirales; Bornaviridae; Bornavirus. OH=8801,9352,9455,9685,9788,9844,9850,9913,9925,9940,9986,30538,56798,109474
Sequence
LVFLCLLIPGLHAAFVHGGVPRESYLSTPVTRGEQTVVKTAKFYGEKTTQRDLTELEISS
IFSHCCSLLIGVVIGSSSKIKAGAEQIKKRFKTMMAALNRPSHGETATLLQMFNPHEAID
WINGQPWVGSFVLSLLTTDFESPGKE
Download sequence
Identical sequences O12852 O12853 O12855 O12856 O12857 O12858 O12859 O12860 O12861 O12862 O12863 O12864 Q65471 Q65472 Q65473
O12852_BDV O12853_BDV O12855_BDV O12856_BDV O12857_BDV O12858_BDV O12859_BDV O12860_BDV O12861_BDV O12862_BDV O12863_BDV O12864_BDV Q65471_BDV Q65472_BDV Q65473_BDV

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]