SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6BVS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q6BVS1
Domain Number - Region: 38-85
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 0.0366
Family RalF, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6BVS1
Sequence length 98
Comment (tr|Q6BVS1|Q6BVS1_DEBHA) DEHA2C00352p {ECO:0000313|EMBL:CAG85720.1} KW=Complete proteome; Reference proteome OX=284592 OS=0083 / IGC 2968) (Yeast) (Torulaspora hansenii). GN=DEHA2C00352g OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Debaryomyces.
Sequence
MIKKRPFRYIKGSYKGEKVWQEIIADINRQVKARVNNKNYEMDDIDAVKDRFFGIMNNFF
RACKKNKKSINDFTNWEKTLLMARNMYDEDVASEKALD
Download sequence
Identical sequences Q6BVS1
XP_457698.1.41535 gnl|GLV|DEHA2C00352g 4959.Q6BVS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]