SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6P9A3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6P9A3
Domain Number 1 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 22-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.91e-22
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 4 Region: 315-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.04e-21
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 537-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 579-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 481-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 259-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-17
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 9 Region: 223-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000644
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  Q6P9A3
Domain Number - Region: 103-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00121
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 169-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0461
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6P9A3
Sequence length 640
Comment (sp|Q6P9A3|ZN549_HUMAN) Zinc finger protein 549 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF549; OC=Catarrhini; Hominidae; Homo.
Sequence
MAEAALVITPQIPMVTEEFVKPSQGHVTFEDIAVYFSQEEWGLLDEAQRCLYHDVMLENF
SLMASVGCLHGIEAEEAPSEQTLSAQGVSQARTPKLGPSIPNAHSCEMCILVMKDILYLS
EHQGTLPWQKPYTSVASGKWFSFGSNLQQHQNQDSGEKHIRKEESSALLLNSCKIPLSDN
LFPCKDVEKDFPTILGLLQHQTTHSRQEYAHRSRETFQQRRYKCEQVFNEKVHVTEHQRV
HTGEKAYKRREYGKSLNSKYLFVEHQRTHNAEKPYVCNICGKSFLHKQTLVGHQQRIHTR
ERSYVCIECGKSLSSKYSLVEHQRTHNGEKPYVCNVCGKSFRHKQTFVGHQQRIHTGERP
YVCMECGKSFIHSYDRIRHQRVHTGEGAYQCSECGKSFIYKQSLLDHHRIHTGERPYECK
ECGKAFIHKKRLLEHQRIHTGEKPYVCIICGKSFIRSSDYMRHQRIHTGERAYECSDCGK
AFISKQTLLKHHKIHTRERPYECSECGKGFYLEVKLLQHQRIHTREQLCECNECGKVFSH
QKRLLEHQKVHTGEKPCECSECGKCFRHRTSLIQHQKVHSGERPYNCTACEKAFIYKNKL
VEHQRIHTGEKPYECGKCGKAFNKRYSLVRHQKVHITEEP
Download sequence
Identical sequences Q6P9A3
ENSP00000365407 ENSP00000365407 ENSP00000365407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]