SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q74M39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q74M39
Domain Number 1 Region: 65-233
Classification Level Classification E-value
Superfamily Uracil-DNA glycosylase-like 1.19e-35
Family AF0587 domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q74M39
Sequence length 245
Comment (tr|Q74M39|Q74M39_NANEQ) NEQ526 {ECO:0000313|EMBL:AAR39367.1} KW=Complete proteome; Reference proteome OX=228908 OS=Nanoarchaeum equitans (strain Kin4-M). GN=NEQ526 OC=Archaea; Nanoarchaeota; Nanoarchaeales; Nanoarchaeaceae; Nanoarchaeum.
Sequence
MSCWKPLSKEEFEAIVSKYKDNPKIEIDYENLKFIPKFNEQIKKYYSNKIKGAKVENLVN
EVYEAWFDYIIRIYERPKEKDILMFLPCAAKKPYYKSKTHRTIQRAISGFQIFNRIHRVI
VSNPGIIPWEFHTYWPFNSYDWPEWEETEDIKKLYYWVTYKRVKEFLRRHQYNYYTVYMK
PDSLTYKAVMDASKELNIKIIPLLDEKTYEKCKGQGNPLVKEPCIESLKNNLKQLQKQIY
EGSNS
Download sequence
Identical sequences Q74M39
gi|41615308|ref|NP_963806.1| NYSGXRC-10391k 228908.NEQ526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]