SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q75X06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q75X06
Domain Number 1 Region: 2-179
Classification Level Classification E-value
Superfamily Cag-Z 3.27e-112
Family Cag-Z 0.0000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q75X06
Sequence length 199
Comment (tr|Q75X06|Q75X06_HELPX) Cag pathogenicity island protein {ECO:0000313|EMBL:BAD14025.1} OX=210 OS=Helicobacter pylori (Campylobacter pylori). GN=HP0526 OC=Helicobacteraceae; Helicobacter.
Sequence
MELGFNETERQKILDSNRSLMGNANEVRDKFIQNYASSLKDSNDPQDFLRRVQELRINMQ
KNFISFDVYYNYLNNLVLASYNRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEV
ARISDLVASYLPREYLPPFIDGNMMGVAFQILGIDDFGRKLNEVVQDIGTKYIILSKNKT
YLTSLERAKLITQLKLNLE
Download sequence
Identical sequences Q75X06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]