SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7HNZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7HNZ3
Domain Number 1 Region: 81-242
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit A 3.79e-42
Family F1F0 ATP synthase subunit A 0.0028
Further Details:      
 
Weak hits

Sequence:  Q7HNZ3
Domain Number - Region: 51-76
Classification Level Classification E-value
Superfamily Oncogene products 0.0379
Family Oncogene products 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7HNZ3
Sequence length 248
Comment (tr|Q7HNZ3|Q7HNZ3_PYLLI) ATP synthase subunit a {ECO:0000256|RuleBase:RU004450} OX=2885 OS=Pylaiella littoralis. GN=atp6 OC=Acinetosporaceae; Pylaiella.
Sequence
MFNSPLEQFEILPLLSFGANLFDFSITNAMLTTCVSLSFFLFLFYCLFSYGLNSFPTRWQ
LVLEGLYTSTAGLVWDSVGPRRPKVFPFLFVIFSFILISNVQGLVPYSFTITSHLIQTMV
LALTVFIGVIIIVLAHGFHMLSLFLPGGTSIVLAFLLVPIEIVSYVFKPLSLAVRLFANM
MAGHTLLKVIAAVAWAMMGSGGLLLIAHIVPLGVLVILFGLELAVALIQAYVFTILSCIY
INDAIVLH
Download sequence
Identical sequences Q37601 Q7HNZ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]