SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7N1W4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q7N1W4
Domain Number - Region: 204-254
Classification Level Classification E-value
Superfamily XseB-like 0.0248
Family XseB-like 0.013
Further Details:      
 
Domain Number - Region: 132-176
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.0327
Family Multimerization domain of the phosphoprotein from sendai virus 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7N1W4
Sequence length 404
Comment (tr|Q7N1W4|Q7N1W4_PHOLL) Uncharacterized protein {ECO:0000313|EMBL:CAE15725.1} KW=Complete proteome; Reference proteome OX=243265 OS=105565 / TT01). GN=plu3351 OC=Morganellaceae; Photorhabdus.
Sequence
MNKLNSNNEVKSELHKEYKLIISITVFLLIICFALSFVVTIKRRVVLENAFIKTAPEPVL
FYAEKDIDIKNYNVRDGDVVKKGDSIYNAINPDLEEAESILLQNIKRDNTKINAMEKYID
NVYERMKIEKNYEDFKFNKNESELKNIDSILKDHRDDYDFFSQSYREQMNFVDKLLNQNN
NYLSKKDIIKYKMELFSSRRGLINLESDILDLEKRKYSLDDEQSRYIIGATKYKELDMEL
NQLRGELSVLVSELNVKNTGMENIKNGKLRIEGIAKADGKVEFNNINGIRPKQVKKGELV
FTIYPDGNHFIAKGVVSEKYIRKIKIGQSVELKMDAYDYLKYGAIKGKVEAIFGVKNGTA
EIVINIVDKRDFDLEFGNSIKAFIILDEVNLYEYIYEIVFPYVA
Download sequence
Identical sequences Q7N1W4
243265.plu3351 gi|37527227|ref|NP_930571.1| WP_011147539.1.100813 WP_011147539.1.49830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]