SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7QH70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7QH70
Domain Number 1 Region: 36-83
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 4.32e-16
Family Cysteine-rich DNA binding domain, (DM domain) 0.0000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7QH70
Sequence length 265
Comment (tr|Q7QH70|Q7QH70_ANOGA) Female-specific doublesex {ECO:0000313|EMBL:AIY68269.1} KW=Complete proteome; Reference proteome OX=7165 OS=Anopheles gambiae (African malaria mosquito). GN=AgaP_AGAP004050 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MVSQDRWTEAMSDSGYDSRTDGNGAASSCNNSLNPRTPPNCARCRNHGLKIGLKGHKRYC
KYRACQCEKCCLTAERQRVMALQTALRRAQTQDEQRALNEGEVPPEPVANIHIPKLSELK
DLKHNMIHNSQPRSFDCDSSTGSMASAPGTSSVPLTIHRRSPGVPHHVPEPQHMGATHSC
VSPEPVNLLPDDELVKRAQWLLEKLGYPWEMMPLMYVILKSADGDVQKAHQRIDEGQAVV
NEYSRLHNLNMFDGVELRNTTRQSG
Download sequence
Identical sequences A0A1Y9J029 Q7QH70
XP_309601.4.40869 AGAP004050-PB AGAP004050-PB|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]