SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7SZ23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7SZ23
Domain Number 1 Region: 86-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.27e-43
Family Glutathione S-transferase (GST), C-terminal domain 0.0000064
Further Details:      
 
Domain Number 2 Region: 4-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.01e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7SZ23
Sequence length 219
Comment (tr|Q7SZ23|Q7SZ23_XENLA) Gstm2-prov protein {ECO:0000313|EMBL:AAH54171.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18014918mg OC=Xenopus.
Sequence
MVVILGYWDIRGLAHSIRLLLEYTGTQYEEKLYVTGDAPNYDKSQWLNEKEKLGLDFPNL
PYLVDGDVKLTQSNAILRYIARKHGLCGESEKEKNYVDLIENQAMDFRMGLVVIAYSPQF
ETLKGPYLEKLPIALKKFSCFLGDRSWFAGDKITYVDFVMYDVLDQHRILDPTCLQNFKN
LQAFLTRFEALPAIDAYMKSSRFMKTPINNRMASWGNKK
Download sequence
Identical sequences Q7SZ23
NP_001080840.1.7800 gi|147905959|ref|NP_001080840| gi|32484222|gb|AAH54171|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]