SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8BVV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8BVV7
Domain Number - Region: 13-101
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000456
Family Calponin-homology domain, CH-domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8BVV7
Sequence length 827
Comment (sp|Q8BVV7|CEP95_MOUSE) Coiled-coil domain-containing protein 45 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Cep95; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MASSEAEWVTIANNLLFKCHIHLRIHELQDCDANVFIALYQSILGEKVPDLIVLPRNQED
EAHNVQAVIDSLALDYLQVSLSHITGENIVKGDNESIRNLLEIFDGLLDYLTEHISESSP
NKSETEQYSKDSHGEEAGEDLERTEEAKWRNASFMRCSFSSDTLGPTWDEDEAESTGEII
RLGDTAHTFSQRSNGAQNSKDLRSRKASASPGVEPPEEMLNPGPLGFLSQNGPPCEAASE
TPPMSMVPSARKLGEPIRAAIPLHPPYHPSEPRAPCPIGKEYLWSSRYLSTPTSGEHMAP
SVEPDDAFLTSTLFKDDDQETYLPKPEATRTRKPSKGERDENRAAIPSEHLPFSQKARKP
LTEQELHAMSEKLSQRLSELDWMLKTALGDRGTGETDGNDGDGGGEEVRSGNEEMLSQHS
DSVMEYGPKKPRPGFSTCRKAPYRSHSLSPSSVNKHRQLEKEKKRQHKSKGTDSCHFQAK
ALTEAFERELRKHKVQENVGLRGIREEEEEEEETGKSYREVVPKGTSKRSQVQKTYSRKT
AAPSPKGDGRLKSSKASPMKVSEHSLLSLMLEQFPFLYVSDPTLTKMWKQQMAQVEQLKR
EAQRENRSKKKLQDEIEEALRRHDLLTALVKKEYDHNKRLQDFRDRIQRQRLTQSKIKEN
RHQSVRARKYYDDYRVQLRAKMMKMRTREEMIFKKLFEEGLQIQKQRLRDLRNYAKEKRN
EEKRQHQNELDSMENHYKDQFSLLAEAISQERQELKVRQKFQAQTLHKVKRELRAKMEKE
IQQLQHMITQNDDDAFFRELEAERFKARLQLASFQYSKNPFPRGQTS
Download sequence
Identical sequences Q8BVV7
NP_796062.2.92730 ENSMUSP00000018516 10090.ENSMUSP00000018516 ENSMUSP00000018516 ENSMUSP00000018516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]