SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8E8Z2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q8E8Z2
Domain Number - Region: 5-29
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.00392
Family ISP transmembrane anchor 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8E8Z2
Sequence length 65
Comment (tr|Q8E8Z2|Q8E8Z2_SHEON) Formate dehydrogenase accessory protein FdhX {ECO:0000313|EMBL:AAN57472.1} KW=Complete proteome; Reference proteome OX=211586 OS=Shewanella oneidensis (strain MR-1). GN=SO_4508 OC=Shewanellaceae; Shewanella.
Sequence
MKKQASDMGRRQLLKALALGSAAGAVATVSSQALAATPTVAPSEPKSDNYRETDHIRNYY
ASLNN
Download sequence
Identical sequences A0A073KHG7 A0A0P7IVB5 A0A1Z4ADV9 A0A252EUB0 A0L264 Q8E8Z2
gi|117922347|ref|YP_871539.1| 211586.SO_4508 94122.Shewana3_3915 2005343311 2005343560 NP_720028.1.27637 WP_011074127.1.101270 WP_011074127.1.29358 WP_011074127.1.37160 WP_011074127.1.419 WP_011074127.1.57664 WP_011074127.1.63360 WP_011074127.1.71012 WP_011074127.1.71831 WP_011074127.1.74954 gi|24375985|ref|NP_720028.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]