SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8IRQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8IRQ6
Domain Number 1 Region: 165-197,236-339,390-439
Classification Level Classification E-value
Superfamily TPR-like 3.6e-22
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Domain Number 2 Region: 23-45,74-113,168-210
Classification Level Classification E-value
Superfamily TPR-like 0.0000149
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q8IRQ6
Sequence length 528
Comment (tr|Q8IRQ6|Q8IRQ6_DROME) Anaphase promoting complex subunit 7, isoform B {ECO:0000313|EMBL:AAN09176.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG14444 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MMRHKNAVLVAIESSYPEFGDAEQRRRAAECYRQIGNTDMAIETLLQVPPTLRSPRINLM
LARLQHHGSRHGTTKKSEAVLAYKEVIRECPMALQVIEALLELGVNGNEINSLVMHAATV
PDHFDWLSKWIKALAQMFNFKHSDASQTFLMLHDNTTLRCNEHLMMALGKCLYYNGDYFQ
AEDIFSSTLCANPDNVEAIGLMAVLCGQEGGCEQDSADMDYLFAKVSSEVKYTASHWFAH
AQLLYDEGKFERGLNFVEKCLDSEPRNHEALILRGRLLIALERHTQAVCAFRTAQMVAPY
RFEIYRGLFHSYLAQKRFKEANALCNWTIRLFQNSPRSFTMFGRTLFLFPDPRMRRTARK
FAEKSLKINHIYTPAVNLIADICQVEGPTKAIIKLLEKHVIIFPKVNLLNHLGDIMRKQK
EPVKAMEYYYKALRQDPKSKRTLRGLRLLAKSDDESPVLDESDDIGMDNQQSINDLTTLC
EATNAQGAEGAESVENSREASSSAAARSGQEEDVDEHDWIDVPDGMSY
Download sequence
Identical sequences Q8IRQ6
FBpp0070908 FBpp0070908 FR741 NP_727101.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]