SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8TI64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8TI64
Domain Number 1 Region: 1385-1569
Classification Level Classification E-value
Superfamily L domain-like 4.37e-27
Family Ngr ectodomain-like 0.02
Further Details:      
 
Domain Number 2 Region: 1697-1782
Classification Level Classification E-value
Superfamily PKD domain 5.36e-27
Family PKD domain 0.00036
Further Details:      
 
Domain Number 3 Region: 573-659
Classification Level Classification E-value
Superfamily PKD domain 9.03e-26
Family PKD domain 0.00027
Further Details:      
 
Domain Number 4 Region: 728-791,924-967,1010-1140
Classification Level Classification E-value
Superfamily L domain-like 1.96e-25
Family Ngr ectodomain-like 0.051
Further Details:      
 
Domain Number 5 Region: 400-490
Classification Level Classification E-value
Superfamily PKD domain 6.93e-25
Family PKD domain 0.0007
Further Details:      
 
Domain Number 6 Region: 1605-1693
Classification Level Classification E-value
Superfamily PKD domain 1.23e-23
Family PKD domain 0.00017
Further Details:      
 
Domain Number 7 Region: 491-569
Classification Level Classification E-value
Superfamily PKD domain 1.09e-22
Family PKD domain 0.0005
Further Details:      
 
Domain Number 8 Region: 1247-1327
Classification Level Classification E-value
Superfamily PKD domain 9.42e-17
Family PKD domain 0.0006
Further Details:      
 
Weak hits

Sequence:  Q8TI64
Domain Number - Region: 1941-1992
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00102
Family Type I dockerin domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8TI64
Sequence length 1995
Comment (tr|Q8TI64|Q8TI64_METAC) Cell surface protein {ECO:0000313|EMBL:AAM07636.1} KW=Complete proteome; Reference proteome OX=188937 OS=C2A). GN=MA_4292 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MLLLSIAMLAMPAVAIGEATITRTITPSEVSDGDTYNVTLTVSFNIDEDSIAIHEALPAD
WNLTEVDSGRYIWNTSEEDYTFLDFYGTANLTGVTDTITYSVTVPDGTVSGTYDYGPSYV
AGESASEEEFAWTENTIGDNTVTVNGTILNIYSTALENTNPGAPDPGIPGFVGPNGDGKT
DCGTVNPIFITWASTVVDYSPANQSITAGFSNPSLALGPVTGDNFNIVSLGDLDQDQINA
GELPGSVTLGFDLPIANGEGPDLAVFENGFIATGTEKIFAELAYVEVSTDGIVFARFPSI
FLTSGEVGGYGSIDPTDVYNLAGKHVNAYGDSWGTPFDLSTLAQAPEVLNGSVNLNSINY
VRIVDIPGSGDFKDSRGNPIYDAWVTWGSGGLDLEAVGVINVGVVSAPVANFTPDVTSGT
APLTVHFNDESTGVIFDYAWDFNNDGIVDSTLQNPSFTYEAPGTYTVSLTVSNTGGSSTE
TKADYIVAALPDSPVADFSVDVTSGSAPLTVQFTDLTTNGPVSWAWDFESDGIIDSYEQN
PSWTYNAAGNYTVTMTATNLVASDTVTRVNLTSVENLPPMADFSADPVATLIGCSVQFTD
LSTNSPTSWQWDFNNDGTIDSTMQNPSYTYTTAGTYTVNLTVSNPAGSGDEVKTDYIVVK
EQASHASDFTYTSDGSSITITEYTGSDGIVIIPAEIEGLPVTTIGASAFYGCSAPTTVTI
PNSVTTIGDSAFQDCSALTTVSIPDSVTTIGDNAFMSCSALTTVNIPDSVTTIGNYAFQD
CSALTTVTIGSGVTTIGTSAFQDCSALATVTIGSGVTTIGTSAFQDCSALTTVTIPDSVT
TIGDSAFGGCSGLTIVTIGSGVTSIGGVTSSSSFVFSDCPTLIAIDVDTDNSAYASIDGI
LYSKDATTLIRCPLGKTGPVSVPNSVTTIERVAFSGCTGLTSVAIPDSITSIGDYAFSSC
SALTAIDVDTDNSVYASIDGILYNKDITTLIRCPPGKTDPVTIPDSVTTIDVSAFSGCTG
LTSVTIPDGVTSIGTYAFYGCSGLATVTIPDSVTTIDASAFRDCTALASVTIGNNVTSIG
YYAFRDCSGLTTVTIPDSVTSIPSYAFSGCSGLTAVTIGSGVTSIGENAFSGCSALAAID
VDTDNSVYASIDGILYNKAITTLIQCPSGQTGSVTIPDSVTSIGRLAFLDCSAPIVMVFE
GNAPTVATYWNYNCPNIAVYYYEGATGFTTPLWNGVPCYPALVAATGNFSSNIVYGSAPL
TVEFTYTGVGANTFAWDFGNDGTVDSTARNPGYTYNVPGTYSVRLNVSNPWGSDSEVKTD
YITIVEPVDNFTYISDGTSVTITGYTGPVGDVVIPSTIKGMPVTTISASAFKSNTNITSA
TTPDSVTSIGDNAFQSCSGLTTVTIGSGVTSIGDSAFYGCNALTSVTIGNNVTTIGTYAF
RGCTALTSVTIPDSVTSIGTYAFYGCTYLTSVTIGNNVTSVGSSAFQDCSVLTSVTIPNS
VTEIGSHAFRDCTTLTSVIIPDSVTSIGSSVFRDCSALTSVTVGNNVTSIGSSMFRDCTA
LTSVMFTGNAPDSVSSSWVDGCPDLVVYYYEGATGFTTPMWNGVACYPLAVAPVADFEAD
VISGIGPMIVNFTDLSTRSPDTWEWDFDNDGTVDSTEQNPSYTYTSAGTYTVNLTVANAN
GTDSELKTDYIIVSSTPAEPEPIAAFTANIIAGTAPLTVNFTDQSTGSPTAWAWDFDNDG
NVDSSEQNPSYTYNAAGNYTVNLTVENAAGMDFELKTDYIEVSEASGSTVTLYFDPESSS
VAENESTEINLVASNFPEGFSGYNLTIAIDDPAVAEIVDIEYPTWALITENSSLPWTSIY
LKAVDGEDTVKEGGTDVVLATLTVSGKEKGSANLSIGVDRLDDDSGETIEPEFLTGKIEV
TLLSPLPDQEYAPKDLNGDGLYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGN
GRIDFDDVVDMFAMI
Download sequence
Identical sequences Q8TI64
gi|20093081|ref|NP_619156.1| WP_011024173.1.98848 188937.MA4292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]