SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8VE01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8VE01
Domain Number 1 Region: 14-162
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-38
Family Dual specificity phosphatase-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8VE01
Sequence length 188
Comment (sp|Q8VE01|DUS18_MOUSE) Dual specificity protein phosphatase 18 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Dusp18; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MTSPWSAFPVQIPQPSIRGLSQITKSLFISNGVAANNKLLLSSNQITTVINVSVEVANTF
YEDIQYVQVPVVDAPVARLSNFFDSVADRIHSVEMQKGRTLLHCAAGVSRSAALCLAYLM
KYHAMSLVDAHTWTKSCRPIIRPNSGFWEQLIHYELQLFGKNTMQMMDSPMGRIPDIYEK
ETRLMIPL
Download sequence
Identical sequences Q8VE01
ENSMUSP00000057346 ENSMUSP00000057346 ENSMUSP00000105624 10090.ENSMUSP00000057346 ENSMUSP00000057346 NP_776106.1.92730 XP_006514936.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]