SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q91DE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q91DE7
Domain Number 1 Region: 90-168
Classification Level Classification E-value
Superfamily T-antigen specific domain-like 2.22e-29
Family T-antigen specific domain-like 0.0000438
Further Details:      
 
Domain Number 2 Region: 5-117
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.62e-20
Family Chaperone J-domain 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q91DE7
Sequence length 172
Comment (tr|Q91DE7|Q91DE7_POVJC) Small t antigen {ECO:0000313|EMBL:BAB68979.1} KW=Complete proteome OX=10632 OS=JC polyomavirus (JCPyV) (JCV). GN= OC=Viruses; dsDNA viruses, no RNA stage; Polyomaviridae. OH=9606
Sequence
MDKVLNREESMELMDLLGLDRSAWGNIPVMRKAYLKKCKELHPDKGGDEDKMKRMNFLYK
KMEQGVKVAHQPDFGTWNSSEVGCDFPPNSDTLYCKEWPNCATNPSVHCPCLMCMLKLRH
RNRKFLRSSPLVWIDCYCFDCFRQWFGCDLTQEALDCWEKVLGDTPYRDLKL
Download sequence
Identical sequences Q91DE7
Q91DE7_POVJC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]