SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q91XT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q91XT3
Domain Number 1 Region: 6-140
Classification Level Classification E-value
Superfamily Stathmin 9.55e-59
Family Stathmin 0.00000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q91XT3
Sequence length 149
Comment (tr|Q91XT3|Q91XT3_MOUSE) Stathmin {ECO:0000256|RuleBase:RU004388} OX=10090 OS=Mus musculus (Mouse). GN=Stmn1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MASSGIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
ERLREKDKHVEEVRKNKESKDPADETEAD
Download sequence
Identical sequences Q91XT3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]