SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q93FM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q93FM2
Domain Number - Region: 163-204
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0366
Family Multidrug efflux transporter AcrB transmembrane domain 0.024
Further Details:      
 
Domain Number - Region: 104-134
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0863
Family Regulator of G-protein signaling, RGS 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q93FM2
Sequence length 217
Comment (tr|Q93FM2|Q93FM2_CITRO) EscR {ECO:0000313|EMBL:AAL06354.1} OX=67825 OS=Citrobacter rodentium. GN= OC=Enterobacteriaceae; Citrobacter.
Sequence
MTQLMTIGSQPIFLIVVFFFFSLLPIFVVIGTSFLKISIVLGILKNALGIQQVPPNMALT
SVSLILTIFIMSPIILQINDNISQEPINYTDSDFYQKVDGKIISPYRIFLENNTNKENID
FFENVAKKKLGNETSLKKDSLFILLPAFTMGQLEAAFKIGFLLYLPFIAIDLIISNILLA
LGMMMVSPVTISIPFKILLFILIGGWQKLFEFLLVVN
Download sequence
Identical sequences D2TKH0 Q93FM2
gi|283786652|ref|YP_003366517.1| WP_012907134.1.100188 WP_012907134.1.15646 WP_012907134.1.97068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]