SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9BQS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9BQS7
Domain Number 1 Region: 23-212
Classification Level Classification E-value
Superfamily Cupredoxins 1.68e-55
Family Multidomain cupredoxins 0.00000553
Further Details:      
 
Domain Number 2 Region: 222-366
Classification Level Classification E-value
Superfamily Cupredoxins 3.91e-50
Family Multidomain cupredoxins 0.00000411
Further Details:      
 
Domain Number 3 Region: 731-910
Classification Level Classification E-value
Superfamily Cupredoxins 2.22e-48
Family Multidomain cupredoxins 0.00000349
Further Details:      
 
Domain Number 4 Region: 377-571
Classification Level Classification E-value
Superfamily Cupredoxins 1.96e-47
Family Multidomain cupredoxins 0.00000588
Further Details:      
 
Domain Number 5 Region: 918-1064
Classification Level Classification E-value
Superfamily Cupredoxins 4.39e-46
Family Multidomain cupredoxins 0.000004
Further Details:      
 
Domain Number 6 Region: 574-718
Classification Level Classification E-value
Superfamily Cupredoxins 9.5e-43
Family Multidomain cupredoxins 0.0000839
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9BQS7
Sequence length 1158
Comment (sp|Q9BQS7|HEPH_HUMAN) Hephaestin KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HEPH; OC=Catarrhini; Hominidae; Homo.
Sequence
MESGHLLWALLFMQSLWPQLTDGATRVYYLGIRDVQWNYAPKGRNVITNQPLDSDIVASS
FLKSDKNRIGGTYKKTIYKEYKDDSYTDEVAQPAWLGFLGPVLQAEVGDVILIHLKNFAT
RPYTIHPHGVFYEKDSEGSLYPDGSSGPLKADDSVPPGGSHIYNWTIPEGHAPTDADPAC
LTWIYHSHVDAPRDIATGLIGPLITCKRGALDGNSPPQRQDVDHDFFLLFSVVDENLSWH
LNENIATYCSDPASVDKEDETFQESNRMHAINGFVFGNLPELNMCAQKRVAWHLFGMGNE
IDVHTAFFHGQMLTTRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQAL
YKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSISDKFFQKS
SSRIGGTYWKVRYEAFQDETFQEKMHLEEDRHLGILGPVIRAEVGDTIQVVFYNRASQPF
SMQPHGVFYEKDYEGTVYNDGSSYPGLVAKPFEKVTYRWTVPPHAGPTAQDPACLTWMYF
SAADPIRDTNSGLVGPLLVCRAGALGADGKQKGVDKEFFLLFTVLDENKSWYSNANQAAA
MLDFRLLSEDIEGFQDSNRMHAINGFLFSNLPRLDMCKGDTVAWHLLGLGTETDVHGVMF
QGNTVQLQGMRKGAAMLFPHTFVMAIMQPDNLGTFEIYCQAGSHREAGMRAIYNVSQCPG
HQATPRQRYQAARIYYIMAEEVEWDYCPDRSWEREWHNQSEKDSYGYIFLSNKDGLLGSR
YKKAVFREYTDGTFRIPRPRTGPEEHLGILGPLIKGEVGDILTVVFKNNASRPYSVHAHG
VLESTTVWPLAAEPGEVVTYQWNIPERSGPGPNDSACVSWIYYSAVDPIKDMYSGLVGPL
AICQKGILEPHGGRSDMDREFALLFLIFDENKSWYLEENVATHGSQDPGSINLQDETFLE
SNKMHAINGKLYANLRGLTMYQGERVAWYMLAMGQDVDLHTIHFHAESFLYRNGENYRAD
VVDLFPGTFEVVEMVASNPGTWLMHCHVTDHVHAGMETLFTVFSRTEHLSPLTVITKETE
KAVPPRDIEEGNVKMLGMQIPIKNVEMLASVLVAISVTLLLVVLALGGVVWYQHRQRKLR
RNRRSILDDSFKLLSFKQ
Download sequence
Identical sequences Q1HE23 Q9BQS7
ENSP00000343939 ENSP00000343939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]