SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9DEW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9DEW1
Domain Number 1 Region: 2-30
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.00000000262
Family Cysteine-rich DNA binding domain, (DM domain) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9DEW1
Sequence length 31
Comment (tr|Q9DEW1|Q9DEW1_COTCO) Doublesex-related protein Dmrt16 {ECO:0000313|EMBL:AAG15565.1} OX=9091 OS=Coturnix coturnix (Common quail) (Tetrao coturnix). GN=Dmrt16 OC=Phasianidae; Perdicinae; Coturnix.
Sequence
FVVPVKGHAGQCHWKLCLCEKCSLIAERQKI
Download sequence
Identical sequences Q9DEW1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]