SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9DFI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9DFI7
Domain Number 1 Region: 2-31
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 0.0000000000366
Family Cysteine-rich DNA binding domain, (DM domain) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9DFI7
Sequence length 31
Comment (tr|Q9DFI7|Q9DFI7_MONAL) Double-sex like protein Dmrt5 {ECO:0000313|EMBL:AAG18566.1} OX=43700 OS=Monopterus albus (Swamp eel). GN= OC=Anabantaria; Synbranchiformes; Synbranchidae; Monopterus.
Sequence
VVSALKGHKRFCRWRDCVCAKCTLIAERQRV
Download sequence
Identical sequences Q9DFH8 Q9DFI7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]