SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9JMB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9JMB7
Domain Number 1 Region: 410-862
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.31e-129
Family PIWI domain 0.0036
Further Details:      
 
Domain Number 2 Region: 114-434
Classification Level Classification E-value
Superfamily PAZ domain 1.51e-87
Family PAZ domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9JMB7
Sequence length 862
Comment (sp|Q9JMB7|PIWL1_MOUSE) Piwi-like protein 1 {ECO:0000305} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Miwi OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MTGRARARARGRARGQETVQHVGAAASQQPGYIPPRPQQSPTEGDLVGRGRQRGMVVGAT
SKSQELQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVKLSTNHF
RLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGRCHAFDGTILFLPKRLQHKVT
EVFSQTRNGEHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYYNPSDPI
DIPNHRLVIWPGFTTSILQYENNIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQV
SKELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQ
PVLVSQPKRRRGPGGTLPGPAMLIPELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQR
EVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWS
KETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGIQMKKAIMIEVDDRTE
AYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMA
IATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWF
SRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQ
FLDCLKSVGRGYNPRLTVIVVKKRVNARFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFI
VSQAVRSGSVSPTHYNVIYDSSGLKPDHIQRLTYKLCHVYYNWPGVIRVPAPCQYAHKLA
FLVGQSIHREPNLSLSNRLYYL
Download sequence
Identical sequences D3ZTP9 Q9JMB7
10090.ENSMUSP00000083222 10116.ENSRNOP00000001238 ENSRNOP00000001238 ENSMUSP00000083222 ENSMUSP00000083222 NP_001102323.1.100692 NP_001102323.1.4139 NP_067286.1.92730 XP_006504381.1.92730 XP_017453900.1.100692 ENSMUSP00000083222 ENSRNOP00000001238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]