SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9KC21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9KC21
Domain Number - Region: 68-108
Classification Level Classification E-value
Superfamily Proteasome activator 0.0115
Family Proteasome activator 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9KC21
Sequence length 134
Comment (tr|Q9KC21|Q9KC21_BACHD) BH1753 protein {ECO:0000313|EMBL:BAB05472.1} KW=Complete proteome; Reference proteome OX=272558 OS=9153 / C-125). GN=BH1753 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKLNLRKKLIAGVTFLGIFGAMSGVALAEDDAVGGWVEGEGYWTSKDNYEIRKSSSPTSH
QGWKQVRERSGGKQYRAVGVTQWSKQHYTRAQMVGRVSGYVHADSYRVWGTDSTEARSPW
ISKNYQARTFYGSK
Download sequence
Identical sequences Q9KC21
272558.BH1753 gi|15614316|ref|NP_242619.1| WP_010897914.1.28103 WP_010897914.1.91347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]