SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9NZ72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NZ72
Domain Number 1 Region: 39-175
Classification Level Classification E-value
Superfamily Stathmin 1.28e-51
Family Stathmin 0.00000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9NZ72
Sequence length 180
Comment (sp|Q9NZ72|STMN3_HUMAN) SCG10-like protein KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=STMN3; OC=Catarrhini; Hominidae; Homo.
Sequence
MASTISAYKEKMKELSVLSLICSCFYTQPHPNTVYQYGDMEVKQLDKRASGQSFEVILKS
PSDLSPESPMLSSPPKKKDTSLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHK
ALEENNNFSRQAEEKLNYKMELSKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG
Download sequence
Identical sequences A0A2J8RAY4 H2R8T0 Q5R8C6 Q9NZ72
9606.ENSP00000359070 NP_001127491.1.23681 NP_056978.2.87134 NP_056978.2.92137 XP_514783.3.37143 ENSGGOP00000004679 ENSPTRP00000051938 ENSGGOP00000004679 ENSP00000359070 ENSP00000359070 gi|14670375|ref|NP_056978.2| ENSPTRP00000051938 ENSP00000359070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]