SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9PZ45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9PZ45
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 1.47e-29
Family MMLV matrix protein-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9PZ45
Sequence length 137
Comment (tr|Q9PZ45|Q9PZ45_9RETR) Gag polyprotein {ECO:0000313|EMBL:AAD48374.1} OX=89382 OS=Multiple sclerosis associated retrovirus element. GN= OC=Viruses; Retro-transcribing viruses; Retroviridae.
Sequence
MGNVPPEAKMPLERILENWDQCDTQTLRKKRFIFFCSTAWPQYPLQGRETWLPEGSINYN
IILQLDLFCRKEGKWSEVPYVQTFFSLRDNSQLCKKCGLCPTGSPQSPPPYPSVPSPTPS
STNKDPPLTQTPVQKDI
Download sequence
Identical sequences Q9PZ45
Q9PZ45_9RETR

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]