SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9UIW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UIW2
Domain Number 1 Region: 43-512
Classification Level Classification E-value
Superfamily Sema domain 1.01e-131
Family Sema domain 0.0000181
Further Details:      
 
Domain Number 2 Region: 1356-1482,1677-1866
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-53
Family p120GAP domain-like 0.032
Further Details:      
 
Domain Number 3 Region: 1045-1149
Classification Level Classification E-value
Superfamily E set domains 5.1e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.075
Further Details:      
 
Domain Number 4 Region: 958-1046
Classification Level Classification E-value
Superfamily E set domains 9.42e-16
Family Other IPT/TIG domains 0.029
Further Details:      
 
Domain Number 5 Region: 861-959
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000366
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 6 Region: 515-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000157
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1146-1236
Classification Level Classification E-value
Superfamily E set domains 0.000000406
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 8 Region: 814-847
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000275
Family Plexin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9UIW2
Sequence length 1896
Comment (sp|Q9UIW2|PLXA1_HUMAN) Semaphorin receptor NOV KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PLXNA1; OC=Catarrhini; Hominidae; Homo.
Sequence
MPLPPRSLQVLLLLLLLLLLLPGMWAEAGLPRAGGGSQPPFRTFSASDWGLTHLVVHEQT
GEVYVGAVNRIYKLSGNLTLLRAHVTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLL
DYAANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVQEAGSMAGVLIAGPPGQ
GQAKLFVGTPIDGKSEYFPTLSSRRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFP
AFDIYYVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTSKIVRLCVDDPKFYSYVEFPI
GCEQAGVEYRLVQDAYLSRPGRALAHQLGLAEDEDVLFTVFAQGQKNRVKPPKESALCLF
TLRAIKEKIKERIQSCYRGEGKLSLPWLLNKELGCINSPLQIDDDFCGQDFNQPLGGTVT
IEGTPLFVDKDDGLTAVAAYDYRGRTVVFAGTRSGRIRKILVDLSNPGGRPALAYESVVA
QEGSPILRDLVLSPNHQYLYAMTEKQVTRVPVESCVQYTSCELCLGSRDPHCGWCVLHSI
CSRRDACERADEPQRFAADLLQCVQLTVQPRNVSVTMSQVPLVLQAWNVPDLSAGVNCSF
EDFTESESVLEDGRIHCRSPSAREVAPITRGQGDQRVVKLYLKSKETGKKFASVDFVFYN
CSVHQSCLSCVNGSFPCHWCKYRHVCTHNVADCAFLEGRVNVSEDCPQILPSTQIYVPVG
VVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDVS
DLPVNLSVVWNGNFVIDNPQNIQAHLYKCPALRESCGLCLKADPRFECGWCVAERRCSLR
HHCAADTPASWMHARHGSSRCTDPKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGV
RVGKVLCSPVESEYISAEQIVCEIGDASSVRAHDALVEVCVRDCSPHYRALSPKRFTFVT
PTFYRVSPSRGPLSGGTWIGIEGSHLNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQS
PGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPR
IRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLN
STSFLYYPDPVLEPLSPTGLLELKPSSPLILKGRNLLPPAPGNSRLNYTVLIGSTPCTLT
VSETQLLCEAPNLTGQHKVTVRAGGFEFSPGTLQVYSDSLLTLPAIVGIGGGGGLLLLVI
VAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIP
FLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRS
FSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKM
LTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDY
KTLTLNCVNPENENAPEVPVKGLDCDTVTQAKEKLLDAAYKGVPYSQRPKAADMDLEWRQ
GRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSL
SRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVSEIYL
TRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDADVRHTW
KSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKL
LYAKDIPNYKSWVERYYADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYIT
KYKDEILAALEKDEQARRQRLRSKLEQVVDTMALSS
Download sequence
Identical sequences Q9UIW2
gi|262118282|ref|NP_115618.3| ENSP00000377061 NP_115618.3.87134 NP_115618.3.92137 ENSP00000377061 ENSP00000251772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]