SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VTB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9VTB8
Domain Number - Region: 741-809
Classification Level Classification E-value
Superfamily RING/U-box 0.0283
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VTB8
Sequence length 1135
Comment (tr|Q9VTB8|Q9VTB8_DROME) Tonalli, isoform A {ECO:0000313|EMBL:AAF50134.3} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG7958 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MQLIVDKIPMYSKQTTKRNSKKKNDEMNQQAGSSRAPATGGQISPPGATTVGVEQQQHLQ
QQHQQQYYNQQQQQQQQQYQQQHQRDNFLAYQQQQQQQQQQQQQLQRSGGGGGNFMLGND
LVGGDSLRSLNNTFGPNSEFTSLGGANSSASSSLSGLSSSSSQGYTGMVAASQQHQQQQP
HHHQQQQQQQQQQHMGSMDAMGGYSQMGGGMHPGPNSGMMGNMNGQYMNGGSGQGGYNGA
QGMGMGYGGGGSMGPQRHHQMTPMNQMQNMSMGPGVGGSGGMGGGMNPLQQQAAQQQMGG
MNPMAKMQGMANGGYPQQAPPSLTQQQQQQQQRRMAPYPHPQMHMAQKRAAAGVGGAGGM
YPGNPMQQQQAQMYGNQQMHPGSGGGVPLPMQAGGAGNGYGRSGPMGVGNGGYGRMSAGN
GMGPTGGPVMGPMGPGGMTAGGMGPGPGCMSQQRFMPQGSGGGMPGVGYGGVGGAASHQG
QFYPGSGQSAGMQQAGGMCPAGPGAVATTGNPYQNQGFQQNYQHSPVPGNPTPPLTPACS
VPYVSPNPDIKPPMDNSEEMRLTFPVRDGIILAPFRLLHNLSVSNHVFHLKQNVYNTLMC
RNDLELQLKCFHQDDRQMNTNWPHTVTVSANATPLNIERSEKNSTALRPLYLKAVCQPGR
NTLQLTASSCCCSHLFVLQLVHRPSVRQVLQTLHKRNLLPLEHSVQKIKRNLSQPEANAG
PDATPQQQQQQGGGQQCAKISLKCPITKSRIRLPARGHECKHVQCFDLEAYLMINSERGS
WRCPECSKSAITDTLEIDQYIWAILNTLGNSDVDEVIIDSSANWRALQHNGGMPNAPPPS
NVPSNPSGGSGSNSGNGSVNPTLPVIKQELCDDIAKVMSPGSTQLPTWDSAQAMSPYNMH
DMNSIASGNMMGNGGNTNQHGNRSSYDGFSGNHSDGSGGLPGGDGGVNSLDQLNAMEKSL
SDQMPHTPHTPGAASHPMTPGGPPSVSSSHNEPISGGTPNANGSGSATNGSGNNNSSTGH
NSPQTPGTPSRMGGGMGGSGSADSQQQQQEQLLNSLMSSQTQLKFSESDLSAELQSFDAA
AAAINDTAHDLNLLQDVDPMEILSYLDPQPDLNTPPSSGSSNNNASDDLLATLFD
Download sequence
Identical sequences Q9VTB8
FBpp0075996 FBpp0075996 NP_648412.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]