SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9YKM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9YKM1
Domain Number - Region: 94-114
Classification Level Classification E-value
Superfamily Fe-only hydrogenase smaller subunit 0.0693
Family Fe-only hydrogenase smaller subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9YKM1
Sequence length 192
Comment (tr|Q9YKM1|Q9YKM1_9HIV1) p7 {ECO:0000256|HAMAP-Rule:MF_04081} KW=Complete proteome OX=11676 OS=Human immunodeficiency virus 1. GN=vif OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MENRWQVLIVWQVDRMKIRTWNSLVKHHMYISRRAKGWFYRHHYESRHPKISSEVHIPLG
DAKLVITTYWGLHTGERDWHLGHGVSIEWRLKRFSTQVDPGLADQLIHTHYFDCFADSAI
RKAILGEIVSPRCDYPARHSQVGSLQYLALTAVIKPKKIKPPLPSVQKLVEDRWNKPQKT
RGHRGSHTMNGH
Download sequence
Identical sequences Q9YKM1
Q9YKM1_9HIV1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]