SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R0A9F7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R0A9F7
Domain Number - Region: 123-183
Classification Level Classification E-value
Superfamily YfbU-like 0.017
Family YfbU-like 0.017
Further Details:      
 
Domain Number - Region: 250-285
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.0216
Family Biotin synthase 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R0A9F7
Sequence length 326
Comment (tr|R0A9F7|R0A9F7_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:ENZ48865.1} KW=Complete proteome OX=997894 OS=[Clostridium] bolteae 90A9. GN=HMPREF1085_03415 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MIISASRRTDIPAFYSDWFFKRLEEGYLYVRNPMNPGQVSKILLNQDTVDCFVFWTKDPG
PMMERLSVLDRLGYSYYFQFTLTPYGADVEPGLPHKNELVKTFRELSARLGPERVIWRYD
PVLLSPSYTMEYHFQWFSRLCSSLEGYTHTCVISFLDMYRKIKGRMERIQTRAMTGEDMV
SLATFMGPEAERHGMTVRTCSEAADLSGFHIQKGKCIDDQLIAGLLGRPLDVKKDSTQRE
ECGCVKSVDIGAYNTCSHLCRYCYANFSPDQVEVKRRLHDPDSPLLCGRLTGEERITVRE
MKSVVCPAGDGQMRLAFDVSEDGEPE
Download sequence
Identical sequences R0A9F7
WP_002576452.1.54367 WP_002576452.1.86641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]