SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R4G2C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R4G2C6
Domain Number 1 Region: 134-161
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00000204
Family PMP inhibitors 0.0031
Further Details:      
 
Domain Number 2 Region: 93-120
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00000243
Family PMP inhibitors 0.0029
Further Details:      
 
Weak hits

Sequence:  R4G2C6
Domain Number - Region: 42-84
Classification Level Classification E-value
Superfamily FnI-like domain 0.00419
Family Fibronectin type I module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R4G2C6
Sequence length 163
Comment (tr|R4G2C6|R4G2C6_OCTCY) PACI-Oct-2 {ECO:0000313|EMBL:JAA74589.1} OX=34525 OS=Octopus cyanea (Big blue octopus). GN= OC=Octopus.
Sequence
MLTYLSVFCFFIAAISTGDCHSIAGVFGGKNYSAEEPTIMICIFPPVCYYEGETYEVGET
FSSFMGECTCTPGHMIECFIEICEYKGESYRVGQTFMDDCNHCSCEGNNVVRCTKKLCLT
TDTGCAYNNKVYKVGESYMKDCNTCICKATNTAVCTKMACVLD
Download sequence
Identical sequences R4G2C6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]