SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R5B2P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R5B2P4
Domain Number - Region: 50-86
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.0451
Family Nuclear receptor coactivator interlocking domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R5B2P4
Sequence length 201
Comment (tr|R5B2P4|R5B2P4_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:CCX49508.1} KW=Complete proteome; Reference proteome OX=1262781 OS=Clostridium sp. CAG:226. GN=BN545_00948 OC=Clostridium; environmental samples.
Sequence
MIGEPGSGLQITTKHINWCTSEMYINALTTAGITDAKVIVTAPFDVSGTAALTGIYKAYE
DITGSSLNEIAKAVGVEELITTGNLAEYIGSEEATRLVNGLKEILDQTQTMTDEEVKAEI
DKLCETYNVSLNDSQKNQLVSLCRSLEKLDTDELKDKLVGIAKTVDNAGKIGQTVSKIGE
SIKSFFASVGNFFTRLFGGNK
Download sequence
Identical sequences R5B2P4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]