SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R5D3H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R5D3H2
Domain Number - Region: 2-39
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0187
Family PhnA zinc-binding domain 0.077
Further Details:      
 
Domain Number - Region: 15-109
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0506
Family Regulator of G-protein signaling, RGS 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R5D3H2
Sequence length 154
Comment (tr|R5D3H2|R5D3H2_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CCX74723.1} KW=Complete proteome; Reference proteome OX=1262872 OS=Dorea sp. CAG:105. GN=BN457_02093 OC=Dorea; environmental samples.
Sequence
MKCPICGQQLRPGKKDPNYLLCYNCKKKFKVPQNRKEQKHAPERREPATQETLHRSIKEA
SMQRQEEEEQEQKYSNIPPKSVRKKREDEMRKAYDELLAVEDGRKKKKKTARVEEDYDYD
DVYEEEEKLSKAPVIILGIAIVVVAAVIVYMLLK
Download sequence
Identical sequences R5D3H2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]