SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R5I4W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R5I4W5
Domain Number - Region: 83-119
Classification Level Classification E-value
Superfamily Probable GTPase Der, C-terminal domain 0.0719
Family Probable GTPase Der, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R5I4W5
Sequence length 277
Comment (tr|R5I4W5|R5I4W5_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CCY32022.1} KW=Complete proteome; Reference proteome OX=1262964 OS=Ruminococcus sp. CAG:60. GN=BN729_01113 OC=Ruminococcus; environmental samples.
Sequence
MLFSDKKNLLSLYNALNGKNYSDCDNLEIVTLENAIYMSMKNDLAFILDLDLFLWEHQST
YNPNIPLRDLMYIAKEYEKYIKEKGISLYSSRQQKIPAPQFIVFYNGNRKIGERMEHRLS
DAYETARGEPALELKVLVININEGHNQKLMESCRILKEYAQYVSKVRTYKKTLSLNEAVE
KAVDECIREGILREFLLANKAEVVAMSIFEYDREWEEEILRKEEFEAGREAERKNTEKER
LNAEKERCRAESEKIRADNAEKELLLLKEKLALMQGK
Download sequence
Identical sequences R5I4W5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]