SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R5LGW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R5LGW4
Domain Number 1 Region: 57-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.68e-27
Family Extended AAA-ATPase domain 0.003
Further Details:      
 
Weak hits

Sequence:  R5LGW4
Domain Number - Region: 218-264
Classification Level Classification E-value
Superfamily Hypothetical protein MG354 0.00157
Family Hypothetical protein MG354 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R5LGW4
Sequence length 270
Comment (tr|R5LGW4|R5LGW4_9SPIR) ATPase associated with various cellular activities family protein {ECO:0000313|EMBL:CCY76724.1} KW=Complete proteome; Reference proteome OX=1262760 OS=Brachyspira sp. CAG:700. GN=BN758_01820 OC=environmental samples.
Sequence
MGVDYKFILPLNDNIIDRKIFNFIGYEELIFEIQKISDIVFGNEDKIPVNVLNYFSINGN
VILYGKPGVGKTSISYKIASYVLNEYGIKSYQLSIADIIETNLGETTSNMKSAIKELKNI
SKEYGALLILDEVDRLFIDRENNKEISELKRMLIEFMDFLDNLTINDKVMIIGITNLISI
LDSAFTRRFIFQYEIKNDEKVLYELIKDSNKLLSIEMSEKDLKHYAKLFYKKEKTCDFVK
SVYRKEILNSFDKPKELKNNIIKKFKEMED
Download sequence
Identical sequences R5LGW4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]