SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R5MCV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R5MCV1
Domain Number - Region: 24-85
Classification Level Classification E-value
Superfamily BAH domain 0.0327
Family BAH domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R5MCV1
Sequence length 176
Comment (tr|R5MCV1|R5MCV1_9MOLU) Uncharacterized protein {ECO:0000313|EMBL:CCY89388.1} KW=Complete proteome; Reference proteome OX=1262908 OS=Mycoplasma sp. CAG:956. GN=BN817_01292 OC=environmental samples.
Sequence
MKQKSKYILIPIFIVIIIYLLFNYFIKNIEEDLMDPYIEYPTYTFSGRSEHFKFDTGKVY
FTNKYSQILISDFLQTKKINKLKNERVIISFADKNWSSLNNSKNLNKLEKHIMEFQFYEA
GILCENDSGVDCEKTAFNLANKDNFKDIIKIFIEYCTTDDICLKEQFEINYTNEQV
Download sequence
Identical sequences R5MCV1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]