SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R5NKC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R5NKC3
Domain Number - Region: 24-49
Classification Level Classification E-value
Superfamily Stathmin 0.0183
Family Stathmin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R5NKC3
Sequence length 52
Comment (tr|R5NKC3|R5NKC3_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CCZ04253.1} KW=Complete proteome; Reference proteome OX=1262891 OS=Eubacterium sp. CAG:603. GN=BN730_01017 OC=Eubacterium; environmental samples.
Sequence
MKSKIEKVFVGGRYIPAPQDYYDAPIIRKDISLEQLEKEIKEEEEKSKHRND
Download sequence
Identical sequences A0A1C6EUZ0 R5NKC3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]