SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R6AJQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R6AJQ4
Domain Number - Region: 111-190
Classification Level Classification E-value
Superfamily PMT central region-like 0.0497
Family PMT central region-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R6AJQ4
Sequence length 297
Comment (tr|R6AJQ4|R6AJQ4_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:CDA52228.1} KW=Complete proteome; Reference proteome OX=1262818 OS=Clostridium sp. CAG:533. GN=BN698_00161 OC=Clostridium; environmental samples.
Sequence
MELVLLLLIALFVISYRKNDGESVYKFIAKEVTGLYDKYAPYSFKTVREKSIELGEEYTT
KQYITQVIIFGATGAGIAYLYFYSIIWAIVYGIAAIAFIPYLAFLRCKRIYSEFLFEQIQ
VYTTNVIMEFNTTQSFVKALEGVRDSGVLENPILDDVKLMIDLSYQNGTIEESINYFNQK
YPYYMVKNMHQLFLQITREGAKDSGESLDNMLLDIDMLVEGVYRDKMDREQYHKKFLTFG
FALYLLVMLTQFLLGTESYISMLDRWYVVLLLHAIILINTYFLVDGEKYYNENTGGE
Download sequence
Identical sequences R6AJQ4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]