SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R6I1W6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R6I1W6
Domain Number 1 Region: 67-291
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.47e-46
Family RecA protein-like (ATPase-domain) 0.025
Further Details:      
 
Domain Number 2 Region: 255-269,303-455
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-40
Family ATP-dependent protease Lon (La), catalytic domain 0.0034
Further Details:      
 
Weak hits

Sequence:  R6I1W6
Domain Number - Region: 9-31
Classification Level Classification E-value
Superfamily Microbial and mitochondrial ADK, insert "zinc finger" domain 0.023
Family Microbial and mitochondrial ADK, insert "zinc finger" domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R6I1W6
Sequence length 456
Comment (tr|R6I1W6|R6I1W6_9PROT) DNA repair protein RadA {ECO:0000256|HAMAP-Rule:MF_01498, ECO:0000256|RuleBase:RU003555} KW=Complete proteome; Reference proteome OX=1262706 OS=Azospirillum sp. CAG:260. GN=BN570_01471 OC=Rhodospirillaceae; Azospirillum; environmental samples.
Sequence
MAKKGASEFVCQSCGAVYPKWQGKCDACGEWNTIVEEKSGGEGFSNIAPKRKGRLLEFVP
LSGSQEALTRLVTNIKELDRVCGGGLVPGSAILVGGDPGIGKSTLLLQACASIANLPSHP
ECYYISGEEAIDQVRIRAKRLQLEQSPVKLTSATDVKDIIATLEKSNAAVVIIDSIQTMY
LEEVESTPGSVSQVRACAYELIKLAKKKGFALFLVGHVTKQGAIAGPRVLEHMVDTVLYF
EGERGHHFRILRAVKNRYGATDEIGVFEMQDQGLVEVENPSALFLAERQGNISGSCVFAG
IEGSRPVLVEIQALVSPTSYASPKRAVVGWDSNRLAMVLAVLEARCGMNLSSQDIYLNIA
GGLKISEPAADLAVAMAVISSLTNKPLPADTVIFGEIGLSGEIRAVSQPNARLKEAFKLG
FGSAITPPTHSKEKKHSLDMTCYEIGNVQRLINWFN
Download sequence
Identical sequences A0A1Q6UDP5 R6I1W6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]