SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R6VQL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R6VQL2
Domain Number - Region: 155-213
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0693
Family Clostridium neurotoxins, "coiled-coil" domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R6VQL2
Sequence length 275
Comment (tr|R6VQL2|R6VQL2_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CDC84682.1} KW=Complete proteome OX=1262981 OS=Erysipelotrichaceae bacterium CAG:64. GN=BN746_03081 OC=Erysipelotrichaceae; environmental samples.
Sequence
MQETSDKLCLEYGLSVIKNPQYKSKKVNYHVLNSYMKDIKKDMDILVQQSNFVDVFWDNM
KKKGYALERIGEEYAIYHPYYSEPIFLKTLGEQYHYENIEDRLTDKRILPQETEHTKSYY
QCKEYYKKYKRKQLTGPAGIRVAYLISLDVLPTRKQKLSKEARQALRKLDMFVKEIELLY
HNKIEDINQLDDYQQGKQNELDKLIYERQRCYYHRMKATSEEEKEEWPVQAKQFTPAIKK
LRMEVKACDNIRNRSFKDDVERIAWKKIRQREQSR
Download sequence
Identical sequences R6VQL2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]