SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R6W7U4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R6W7U4
Domain Number - Region: 14-45
Classification Level Classification E-value
Superfamily T-antigen specific domain-like 0.0497
Family T-antigen specific domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R6W7U4
Sequence length 132
Comment (tr|R6W7U4|R6W7U4_9BACE) Uncharacterized protein {ECO:0000313|EMBL:CDC90322.1} KW=Complete proteome OX=1263044 OS=Bacteroides faecis CAG:32. GN=BN607_03429 OC=Bacteroides; environmental samples.
Sequence
MTAHALYTQTLSEYKSRLISSPCLTLRSYCHECHVNYHGMELWLSRHGIRIRELRSSLSV
SSSAKPVPCFSPLVPSSAPSVRPSSSSDMLYGINITFPDGVIISIKQGSSFGIHRFIDLY
NRKIQEEQSCLL
Download sequence
Identical sequences A0A1H3ID14 R6W7U4
WP_022302425.1.2625 WP_022302425.1.98754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]