SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R6WPE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R6WPE0
Domain Number - Region: 51-110
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.00981
Family BRCA2 tower domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R6WPE0
Sequence length 123
Comment (tr|R6WPE0|R6WPE0_9BACT) Uncharacterized protein {ECO:0000313|EMBL:CDD11250.1} KW=Complete proteome; Reference proteome OX=1263094 OS=Parabacteroides merdae CAG:48. GN=BN675_00899 OC=Parabacteroides; environmental samples.
Sequence
MKKVIGLCLVLLISSVSVFAQDGKRGAKKGGDPAQRCEKMIADLKLDEKQAADFRKVEAE
FRDKMKAERKQADLDRRKMREKMMSLRDDRDAEMKKILTEDQYKQYLEKQRPQSPRKRHG
RKE
Download sequence
Identical sequences A7AIF1 R6WPE0
WP_005634005.1.26195 WP_005634005.1.58888 WP_005634005.1.97916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]