SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R6WRF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R6WRF9
Domain Number - Region: 90-124
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 0.0915
Family Ecotin, trypsin inhibitor 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R6WRF9
Sequence length 149
Comment (tr|R6WRF9|R6WRF9_9BACT) META domain protein {ECO:0000313|EMBL:CDC96707.1} KW=Complete proteome; Reference proteome OX=1262693 OS=Alistipes sp. CAG:268. GN=BN576_00300 OC=Alistipes; environmental samples.
Sequence
MKILPKLALAAVAALLCASCCPCRSYQKKTRRPLEGTEWQLIQLGGKSVRPEEGTFSLRF
DAEKQTASGTGACNRFSGRYTAGERRALRIGPLASTMMACPDMDQERDYTEALEATTHYD
MDGPMLLLLANGELRAVFQAQPAPAEEKR
Download sequence
Identical sequences R6WRF9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]