SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7CAH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  R7CAH4
Domain Number - Region: 85-106
Classification Level Classification E-value
Superfamily Inovirus (filamentous phage) major coat protein 0.0384
Family Inovirus (filamentous phage) major coat protein 0.0048
Further Details:      
 
Domain Number - Region: 197-237
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.0458
Family RecG, N-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R7CAH4
Sequence length 272
Comment (tr|R7CAH4|R7CAH4_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:CDD75184.1} KW=Complete proteome; Reference proteome OX=1262828 OS=Clostridium sp. CAG:62. GN=BN737_01371 OC=Clostridium; environmental samples.
Sequence
MAMITCPNCGEQISDKAKSCVHCGVSLQPEEKMICEECGAELEGGIEICPACGCPVAKSG
EEATDVPQQVEVTGVRMTKKAKKIVLLVGGAIILIAAVILGIGMIQKKKAADEAQKAKKE
YAANLKTITYTMLDASGIAEGCGNLIKSVWSNSIYEESDEETDEYTKEDGYFVSDFNEAL
GNLFADSAFSNKVKSVSEKQDTVNSLLKKLNNPPQEYKEAYDKMKEFYDAYITLSNLATS
PSGNLQTYSNSFSEADTKVMNCYKAMQVYLEE
Download sequence
Identical sequences R7CAH4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]