SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R7HDF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R7HDF9
Domain Number 1 Region: 15-187
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 1.22e-21
Family Archaeal IMP cyclohydrolase PurO 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R7HDF9
Sequence length 237
Comment (tr|R7HDF9|R7HDF9_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CDE37003.1} KW=Complete proteome; Reference proteome OX=1262889 OS=Eubacterium sp. CAG:38. GN=BN634_01475 OC=Eubacterium; environmental samples.
Sequence
MEMQMLEKELSGCDYPGRGIVIGKSEDGKKAVTAYFIMGRSENSRNRVFVEDGEGIRTQA
FDPSKLSDPSLIIYAPVRVLGNDTIVTNGDQTDTVYDLMSQGKTFEESLRTREFEPDGPN
YTPRISGIMHIENGTFDYAMSILKSNNGNPAACNRYTFDYRNPVAGEGRFIHTYMKDANP
LPSFEGEPTWVRISGDIDTFTNMIWNNLNEDNKVSLFVRFIDIETGKYETRIINKNK
Download sequence
Identical sequences R7HDF9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]